Anti-IL-22BP / IL22RA2 Antibody (aa33-60)

• Supplier: LifeSpan Bioscience
• Catalog: LS-C83979
• Prices: $455.00
• Sizes: 200 µg
• Host: Goat
• Clonality: Polyclonal
• Applications: ELISA
• Species Reactivities: Human, Monkey
• Antigen: Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (96%); Marmoset (89%); Dog (82%).
• Purity/Format: Immunoaffinity purified
• Description: Goat Polyclonal
• Gene: IL22RA2
• Conjugate: Unconjugated