| Name | Anti-IL21 Receptor Antibody (aa35-64) |
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-C83978 |
| Prices | $455.00 |
| Sizes | 100 µg |
| Host | Goat |
| Clonality | Polyclonal |
| Applications | WB ELISA |
| Species Reactivities | Human, Monkey |
| Antigen | IL21 Receptor antibody was raised against synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor. Percent identity by BLAST analysis: Human (100%); Gibbon, Marmoset (97%). |
| Purity/Format | Immunoaffinity purified |
| Description | Goat Polyclonal |
| Gene | IL21R |
| Conjugate | Unconjugated |
| Supplier Page | Shop |