Anti-IL21 Receptor Antibody (aa35-64)

Name Anti-IL21 Receptor Antibody (aa35-64)
Supplier LifeSpan Bioscience
Catalog LS-C83985
Prices $455.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB ELISA
Species Reactivities Human, Monkey
Antigen IL21 Receptor antibody was raised against synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%); Rat (90%).
Purity/Format Immunoaffinity purified
Description Rabbit Polyclonal
Gene IL21R
Conjugate Unconjugated
Supplier Page Shop