Name | Anti-IL21 Receptor Antibody (aa35-64) |
---|---|
Supplier | LifeSpan Bioscience |
Catalog | LS-C83985 |
Prices | $455.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB ELISA |
Species Reactivities | Human, Monkey |
Antigen | IL21 Receptor antibody was raised against synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%); Rat (90%). |
Purity/Format | Immunoaffinity purified |
Description | Rabbit Polyclonal |
Gene | IL21R |
Conjugate | Unconjugated |
Supplier Page | Shop |