Anti-IL21 Receptor Antibody (aa35-65)

Name Anti-IL21 Receptor Antibody (aa35-65)
Supplier LifeSpan Bioscience
Catalog LS-C187850
Prices $375.00
Sizes 100 µg
Host Goat
Clonality Polyclonal
Isotype IgG
Applications WB ELISA
Species Reactivities Human, Monkey
Antigen IL21 Receptor antibody was raised against synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R. Percent identity by BLAST analysis: Human, Orangutan, Monkey (100%); Chimpanzee, Gibbon (97%).
Purity/Format Affinity purified
Description Goat Polyclonal
Gene IL21R
Conjugate Unconjugated
Supplier Page Shop

Product images