Name | Anti-IL21 Receptor Antibody (aa35-65) |
---|---|
Supplier | LifeSpan Bioscience |
Catalog | LS-C187850 |
Prices | $375.00 |
Sizes | 100 µg |
Host | Goat |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ELISA |
Species Reactivities | Human, Monkey |
Antigen | IL21 Receptor antibody was raised against synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R. Percent identity by BLAST analysis: Human, Orangutan, Monkey (100%); Chimpanzee, Gibbon (97%). |
Purity/Format | Affinity purified |
Description | Goat Polyclonal |
Gene | IL21R |
Conjugate | Unconjugated |
Supplier Page | Shop |