| Name | Anti-TECTA-Picoband-trade-Antibody |
|---|---|
| Supplier | Abgent, a WuXi AppTec company |
| Catalog | ABO10262 |
| Prices | $240.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK), different from the related mouse sequence by three amino acids. |
| Purity/Format | Lyophilized |
| Description | Rabbit Polyclonal |
| Gene | TECTA |
| Supplier Page | Shop |