| Name | Anti-SLC7A3-Picoband-trade-Antibody |
|---|---|
| Supplier | Abgent, a WuXi AppTec company |
| Catalog | ABO13070 |
| Prices | $240.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids. |
| Purity/Format | Lyophilized |
| Description | Rabbit Polyclonal |
| Gene | SLC7A3 |
| Supplier Page | Shop |