Anti-B3GNT8 Antibody

• Supplier: LifeSpan Bioscience
• Catalog: LS-C490358
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC-P WB
• Species Reactivities: Human
• Antigen: B3GNT8 antibody was raised against amino acids ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC of human B3GNT8 were used as the immunogen for the B3GNT8 antibody.
• Purity/Format: Immunoaffinity purified
• Description: Rabbit Polyclonal
• Gene: B3GNTL1
• Conjugate: Unconjugated