Anti-SLC7A3 / CAT-3 Antibody

• Supplier: LifeSpan Bioscience
• Catalog: LS-C662274
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Mouse, Human, Rat, Bat, Bovine, Dog, Guinea Pig, Hamster, Horse, Pig, Rabbit
• Antigen: SLC7A3 / CAT-3 antibody was raised against a synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC7A3
• Conjugate: Unconjugated