Name | Anti-SLC7A3 / CAT-3 Antibody |
---|---|
Supplier | LifeSpan Bioscience |
Catalog | LS-C662274 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Mouse, Human, Rat, Bat, Bovine, Dog, Guinea Pig, Hamster, Horse, Pig, Rabbit |
Antigen | SLC7A3 / CAT-3 antibody was raised against a synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC7A3 |
Conjugate | Unconjugated |
Supplier Page | Shop |