Anti-TECTA Antibody

• Supplier: LifeSpan Bioscience
• Catalog: LS-C662168
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ELISA
• Species Reactivities: Human
• Antigen: TECTA antibody was raised against a synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK), different from the related mouse sequence by three amino acids.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TECTA
• Conjugate: Unconjugated