| Name | TECTA, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS178671 |
| Prices | $280.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK), different from the related mouse sequence by three amino acids. |
| Purity/Format | Immunogen affinity purified. |
| Description | Anti-TECTA Antibody |
| Gene | TECTA |
| Supplier Page | Shop |