Fndc9 antibody

• Supplier: Biorbyt
• Catalog: orb325143
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human, Mouse, Rat, Guinea Pig, Dog, Horse
• Antigen: Synthetic peptide located within the following region: TGAIISWSPSEPCLEDYYHIMYRPNWNSIFSGYLRYNFHHEEKVPRTITS
• Purity/Format: Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description: Rabbit polyclonal antibody to Fndc9
• Gene: Fndc9
• Conjugate: Unconjugated