| Name | Anti-NMS Antibody (aa70-103) |
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-C183992 |
| Prices | $740.00 |
| Sizes | 200 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | NMS antibody was raised against synthetic peptide corresponding to aa70-103 of mouse prepro-Neuromedin S (FLFHYSRTRKPTHPVSAEFAPVHPLMRLAAKLAS). |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NMS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |