Anti-PKC / Protein Kinase C Antibody (C-Terminus)

• Supplier: LifeSpan Bioscience
• Catalog: LS-C17422
• Prices: $485.00
• Sizes: 200 µg
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Rabbit
• Antigen: Synthetic peptide corresponding to amino acids 641-673 of the C-terminus of rabbit Protein Kinase C beta II. [TPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS]. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Rabbit, Horse, Opossum (100%); Platypus (97%); Turkey, Chicken (90%); Xenopus (81%).
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: PRRT2