Anti-TLR10 Antibody (aa81-111)
| Name | Anti-TLR10 Antibody (aa81-111) |
|---|---|
| Supplier | LifeSpan Bioscience |
| Catalog | LS-C83991 |
| Prices | $455.00 |
| Sizes | 200 µg |
| Host | Goat |
| Clonality | Polyclonal |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | TLR10 antibody was raised against 31 amino acid (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-terminal domain of Human TLR10. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%); Orangutan, Monkey (97%); Marmoset (94%); Sheep, Goat, Zebu, Bovine (87%); Elephant, Horse (84%); Panda, Pig (81%). |
| Purity/Format | Immunoaffinity purified |
| Description | Goat Polyclonal |
| Gene | TLR10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
IHC of TLR10 antibody LS-C83991. Human spleen.