WDHD1 Antibody
| Name | WDHD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89091 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | WDHD1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | WDHD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: WDHD1 Antibody [NBP1-89091] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/2475_WDHD1-Antibody-Western-Blot-NBP1-89091-img0005.jpg)
Western Blot: WDHD1 Antibody [NBP1-89091] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431
![Immunocytochemistry/Immunofluorescence: WDHD1 Antibody [NBP1-89091] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/2476_WDHD1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89091-img0007.jpg)
Immunocytochemistry/Immunofluorescence: WDHD1 Antibody [NBP1-89091] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/2477_WDHD1-Antibody-Immunohistochemistry-Paraffin-NBP1-89091-img0006.jpg)
Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.
![Western Blot: WDHD1 Antibody [NBP1-89091] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/2478_WDHD1-Antibody-Western-Blot-NBP1-89091-img0004.jpg)
Western Blot: WDHD1 Antibody [NBP1-89091] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).
![Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091] - Staining of human stomach shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/2479_WDHD1-Antibody-Immunohistochemistry-Paraffin-NBP1-89091-img0001.jpg)
Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091] - Staining of human stomach shows strong nuclear positivity in glandular cells.