SOX10 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-68983
• Prices: $369.00
• Sizes: 50 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the middle region of human SOX10 (NP_008872). Peptide sequence PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SOX10
• Conjugate: Unconjugated

Product images

Western Blot: SOX10 Antibody [NBP1-68983] - Analysis of HepG2 lysate Cell lysates, Antibody Dilution: 0.5 ug/ml.

Immunohistochemistry-Paraffin: SOX10 Antibody [NBP1-68983] - Human Kidney tissue, Epithelial cells of renal tubule (Indicated with Arrows) 4-8 ug/ml.

Western Blot: SOX10 Antibody [NBP1-68983] - HepG2, 0.25ug/ml.

Western Blot: SOX10 Antibody [NBP1-68983] - SOX10 antibody - middle region validated by WB using Hek 293 Whole Cell Lysate at 1:4,000.

Western Blot: SOX10 Antibody [NBP1-68983] - Sample Tissue: Jurkat cell lysates Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration:2.5ug/ml Peptide Concentration: 4.0ug/ml Lysate Quantity: 25ug/lane Gel Concentration:

Immunohistochemistry-Paraffin: SOX10 Antibody [NBP1-68983] - Human Kidney Tissue. Arrow indicates epithelial cells of renal tubule with positive label.

Immunohistochemistry-Paraffin: SOX10 Antibody [NBP1-68983] - Human Skin Tissue with epidermal cells positively labeled.