AGXT Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-89200
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB Simple Western IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: AGXT Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: AGXT
• Conjugate: Unconjugated

Product images

Western Blot: AGXT Antibody [NBP1-89200] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human liver shows strong cytoplasmic positivity in granular pattern in hepatocytes.

Simple Western: AGXT Antibody [NBP1-89200] - Simple Western lane view shows a specific band for AGXT in 0.2 mg/ml of Liver (left), HepG2 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: AGXT Antibody [NBP1-89200] - Electropherogram image(s) of corresponding Simple Western lane view. AGXT antibody was used at 1:20 dilution on Liver lysate(s).

Simple Western: AGXT Antibody [NBP1-89200] - Electropherogram image(s) of corresponding Simple Western Lane view. AGXT antibody was used at 1:20 dilution on HepG2 lysate(s).