ZNF24 Antibody
| Name | ZNF24 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82866 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF24 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF24 |
| Supplier Page | Shop |
Product images
![Western Blot: ZNF24 Antibody [NBP1-82866] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: Negative control (vector only transfected HEK293T lysate) | Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/8096_ZNF24-Antibody-Western-Blot-NBP1-82866-img0003.jpg)
Western Blot: ZNF24 Antibody [NBP1-82866] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: Negative control (vector only transfected HEK293T lysate) | Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells.
![Immunocytochemistry/Immunofluorescence: ZNF24 Antibody [NBP1-82866] - Staining of human cell line U-251MG shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/8097_ZNF24-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82866-img0004.jpg)
Immunocytochemistry/Immunofluorescence: ZNF24 Antibody [NBP1-82866] - Staining of human cell line U-251MG shows positivity in nucleus.
![Immunohistochemistry-Paraffin: ZNF24 Antibody [NBP1-82866] - Immunohistochemical staining of human lymph node shows strong cytoplasmic and nuclear positivity in subsets of cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/8098_ZNF24-Antibody-Immunohistochemistry-Paraffin-NBP1-82866-img0001.jpg)
Immunohistochemistry-Paraffin: ZNF24 Antibody [NBP1-82866] - Immunohistochemical staining of human lymph node shows strong cytoplasmic and nuclear positivity in subsets of cells.
![Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 expression in U2OS and HEK cells. siRNA against ZNF24 show the specificity of the antibody. ZNF24 was used 1/500 in TBST 5% milk, 1 hour at room temperature. Image provided via product review by verified customer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/8099_ZNF24-Antibody-Western-Blot-NBP1-82866-img0005.jpg)
Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 expression in U2OS and HEK cells. siRNA against ZNF24 show the specificity of the antibody. ZNF24 was used 1/500 in TBST 5% milk, 1 hour at room temperature. Image provided via product review by verified customer.
![Western Blot: ZNF24 Antibody [NBP1-82866] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416290)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/8100_ZNF24%2520Antibody-Western%2520Blot-NBP1-82866-img0006.jpg)
Western Blot: ZNF24 Antibody [NBP1-82866] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416290)