Rhot1 Antibody

Name Rhot1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59021
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the N terminal of RHOT1 (NP_060777). Peptide sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RHOT1
Conjugate Unconjugated
Supplier Page Shop

Product images