MCT3/SLC16A8 Antibody
| Name | MCT3/SLC16A8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59885 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC16A8(solute carrier family 16, member 8 (monocarboxylic acid transporter 3)) The peptide sequence was selected from the middle region of SLC16A8. Peptide sequence RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTD |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC16A8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MCT3/SLC16A8 Antibody [NBP1-59885] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28154_MCT3-SLC16A8-Antibody-Western-Blot-NBP1-59885-img0001.jpg)
Western Blot: MCT3/SLC16A8 Antibody [NBP1-59885] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml
![Immunohistochemistry-Paraffin: MCT3/SLC16A8 Antibody [NBP1-59885] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28155_MCT3-SLC16A8-Antibody-Immunohistochemistry-Paraffin-NBP1-59885-img0002.jpg)
Immunohistochemistry-Paraffin: MCT3/SLC16A8 Antibody [NBP1-59885] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
![Western Blot: MCT3/SLC16A8 Antibody [NBP1-59885] - analysis of MCT3 in porcine and mouse (far right lane) skeletal muscle lysates using anti-MCT3 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28156_MCT3-SLC16A8-Antibody-Western-Blot-NBP1-59885-img0003.jpg)
Western Blot: MCT3/SLC16A8 Antibody [NBP1-59885] - analysis of MCT3 in porcine and mouse (far right lane) skeletal muscle lysates using anti-MCT3 antibody. Image from verified customer review.