ADAM19 Antibody
| Name | ADAM19 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69364 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19 (NP_075525). Peptide sequence VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ADAM19 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ADAM19 Antibody [NBP1-69364] - This Anti-ADAM19 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/9021_ADAM19-Antibody-Western-Blot-NBP1-69364-img0003.jpg)
Western Blot: ADAM19 Antibody [NBP1-69364] - This Anti-ADAM19 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.
![Western Blot: ADAM19 Antibody [NBP1-69364] - Analysis of ADAM19 in HeLa whole cell lyaste (30ug) using anti-ADAM19 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/9022_ADAM19-Antibody-Western-Blot-NBP1-69364-img0002.jpg)
Western Blot: ADAM19 Antibody [NBP1-69364] - Analysis of ADAM19 in HeLa whole cell lyaste (30ug) using anti-ADAM19 antibody. Image from verified customer review.