LIV-1/Zip6 Antibody
| Name | LIV-1/Zip6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59357 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC39A6(solute carrier family 39 (zinc transporter), member 6) The peptide sequence was selected from the middle region of SLC39A6. Peptide sequence RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC39A6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8875_LIV-1-Zip6-Antibody-Western-Blot-NBP1-59357-img0003.jpg)
Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.
![Immunohistochemistry-Paraffin: LIV-1/Zip6 Antibody [NBP1-59357] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8876_LIV-1-Zip6-Antibody-Immunohistochemistry-Paraffin-NBP1-59357-img0002.jpg)
Immunohistochemistry-Paraffin: LIV-1/Zip6 Antibody [NBP1-59357] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
![Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: MCF7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8877_LIV-1-Zip6-Antibody-Western-Blot-NBP1-59357-img0008.jpg)
Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: MCF7.
![Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8878_LIV-1-Zip6-Antibody-Western-Blot-NBP1-59357-img0007.jpg)
Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: 721_B.
![Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: 293T.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8879_LIV-1-Zip6-Antibody-Western-Blot-NBP1-59357-img0006.jpg)
Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: 293T.
![Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: Human Fetal Brain.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/8880_LIV-1-Zip6-Antibody-Western-Blot-NBP1-59357-img0009.jpg)
Western Blot: LIV-1/Zip6 Antibody [NBP1-59357] - Sample Tissue: Human Fetal Brain.