MAT1A Antibody
| Name | MAT1A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55120 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MAT1A(methionine adenosyltransferase I, alpha) The peptide sequence was selected from the N terminal of MAT1A (NP_000420). Peptide sequence TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | MAT1A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MAT1A Antibody [NBP1-55120] - Antibody Titration: 1. 25 ug/ml Positive control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5031_MAT1A%2520Antibody-Western%2520Blot-NBP1-55120-img0007.jpg)
Western Blot: MAT1A Antibody [NBP1-55120] - Antibody Titration: 1. 25 ug/ml Positive control: Jurkat cell lysate.
![Immunohistochemistry-Paraffin: MAT1A Antibody [NBP1-55120] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5032_MAT1A-Antibody-Immunohistochemistry-Paraffin-NBP1-55120-img0005.jpg)
Immunohistochemistry-Paraffin: MAT1A Antibody [NBP1-55120] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
![Western Blot: MAT1A Antibody [NBP1-55120] - WB analysis of MAT1A in mouse liver lysate. Image courtesy of product review submitted by Hua Jiang.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/5033_MAT1A-Antibody-Western-Blot-NBP1-55120-img0006.jpg)
Western Blot: MAT1A Antibody [NBP1-55120] - WB analysis of MAT1A in mouse liver lysate. Image courtesy of product review submitted by Hua Jiang.