FBXL7 Antibody
| Name | FBXL7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55053 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P IP |
| Species Reactivities | Human, Mouse, Rat, Bovine, Horse, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to FBXL7(F-box and leucine-rich repeat protein 7) The peptide sequence was selected from the N terminal of FBXL7. Peptide sequence IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | FBXL7 |
| Supplier Page | Shop |
Product images
![Western Blot: FBXL7 Antibody [NBP1-55053] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/8308_FBXL7%2520Antibody-Western%2520Blot-NBP1-55053-img0001.jpg)
Western Blot: FBXL7 Antibody [NBP1-55053] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
![Immunohistochemistry-Paraffin: FBXL7 Antibody [NBP1-55053] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/8309_FBXL7%2520Antibody-Immunohistochemistry-Paraffin-NBP1-55053-img0002.jpg)
Immunohistochemistry-Paraffin: FBXL7 Antibody [NBP1-55053] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Product References
F-box protein Fbxl18 mediates polyubiquitylation and proteasomal degradation of - F-box protein Fbxl18 mediates polyubiquitylation and proteasomal degradation of
Liu Y, Lear T, Zhao Y, Zhao J, Zou C, Chen BB, Mallampalli RK. Cell Death Dis. 2015 Feb 5;6:e1630.
The Proapoptotic F-box Protein Fbxl7 Regulates Mitochondrial Function by - The Proapoptotic F-box Protein Fbxl7 Regulates Mitochondrial Function by
Liu Y, Lear T, Iannone O, Shiva S, Corey C, Rajbhandari S, Jerome J, Chen BB, Mallampalli RK. J Biol Chem. 2015 May 8;290(19):11843-52.