SLC6A14 Antibody
| Name | SLC6A14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86521 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC6A14 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC6A14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC6A14 Antibody [NBP1-86521] - Staining of human cell line Hep G2 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12546_SLC6A14-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86521-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC6A14 Antibody [NBP1-86521] - Staining of human cell line Hep G2 shows localization to vesicles.
![Immunohistochemistry-Paraffin: SLC6A14 Antibody [NBP1-86521] - Staining of human esophagus shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12547_SLC6A14%2520Antibody-Immunohistochemistry-Paraffin-NBP1-86521-img0005.jpg)
Immunohistochemistry-Paraffin: SLC6A14 Antibody [NBP1-86521] - Staining of human esophagus shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.