SSR3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-80667
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SSR3 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: SSR3
• Conjugate: Unconjugated

Product images

Western Blot: SSR3 Antibody [NBP1-80667] - Analysis in human cell line RPMI-8226.

Immunocytochemistry/Immunofluorescence: SSR3 Antibody [NBP1-80667] - Staining of mouse trigeminal nucleus shows positivity in neurons and their processes.

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Western Blot: SSR3 Antibody [NBP1-80667] - Analysis of human dermal fibroblasts at 1:500 dilution. Image provided by verified customer review.

Western Blot: SSR3 Antibody [NBP1-80667] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Western Blot: SSR3 Antibody [NBP1-80667] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebellum tissue

Western Blot: SSR3 Antibody [NBP1-80667] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: SSR3 Antibody [NBP1-80667] - Staining of mouse choroid plexus shows strong immunoreactivity in a subset of cells.

Immunocytochemistry/Immunofluorescence: SSR3 Antibody [NBP1-80667] - Staining of mouse brain shows strong immunoreactivity in median eminens.

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human lateral ventricle shows weak positivity in neuropil and a few neurons.

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of mouse basal forebrain shows weak labeling in the caudate putamen.