GRSF1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57316
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to GRSF1(G-rich RNA sequence binding factor 1) The peptide sequence was selected from the middle region of GRSF1 (NP_002083). Peptide sequence IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: GRSF1
• Conjugate: Unconjugated

Product images

Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Western Blot: GRSF1 Antibody [NBP1-57316] - Hela cell lysate, concentration 0.2-1 ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Brain. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Heart. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Brain. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Liver. Concentration1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Lung. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Jurkat. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Liver. Concentration1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Hela. Concentration 1.0ug/ml.

Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml