MKL2 Antibody
| Name | MKL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83535 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MKL2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MKL2 |
| Supplier Page | Shop |
Product images
![Western Blot: MKL2 Antibody [NBP1-83535] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/11835_MKL2-Antibody-Western-Blot-NBP1-83535-img0006.jpg)
Western Blot: MKL2 Antibody [NBP1-83535] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
![Immunocytochemistry/Immunofluorescence: MKL2 Antibody [NBP1-83535] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/11836_MKL2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83535-img0004.jpg)
Immunocytochemistry/Immunofluorescence: MKL2 Antibody [NBP1-83535] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: MKL2 Antibody [NBP1-83535] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/11837_MKL2-Antibody-Immunohistochemistry-Paraffin-NBP1-83535-img0002.jpg)
Immunohistochemistry-Paraffin: MKL2 Antibody [NBP1-83535] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.
![Western Blot: MKL2 Antibody [NBP1-83535] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/11838_MKL2%2520Antibody-Western%2520Blot-NBP1-83535-img0005.jpg)
Western Blot: MKL2 Antibody [NBP1-83535] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Simple Western: MKL2 Antibody [NBP1-83535] - Simple Western lane view shows a specific band for MKL2 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/11839_MKL2-Antibody-Simple-Western-NBP1-83535-img0007.jpg)
Simple Western: MKL2 Antibody [NBP1-83535] - Simple Western lane view shows a specific band for MKL2 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.