MNAB Antibody
| Name | MNAB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55060 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RC3H2(ring finger and CCCH-type zinc finger domains 2) The peptide sequence was selected from the middle region of RC3H2. Peptide sequence YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RC3H2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MNAB Antibody [NBP1-55060] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29897_MNAB-Antibody-Western-Blot-NBP1-55060-img0008.jpg)
Western Blot: MNAB Antibody [NBP1-55060] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: MNAB Antibody [NBP1-55060] - Human Adult Placenta.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29898_MNAB-Antibody-Western-Blot-NBP1-55060-img0003.jpg)
Western Blot: MNAB Antibody [NBP1-55060] - Human Adult Placenta.
![Western Blot: MNAB Antibody [NBP1-55060] - Human Fetal Lung.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29899_MNAB-Antibody-Western-Blot-NBP1-55060-img0006.jpg)
Western Blot: MNAB Antibody [NBP1-55060] - Human Fetal Lung.
![Western Blot: MNAB Antibody [NBP1-55060] - PANC1 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29900_MNAB-Antibody-Western-Blot-NBP1-55060-img0002.jpg)
Western Blot: MNAB Antibody [NBP1-55060] - PANC1 cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: MNAB Antibody [NBP1-55060] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml RC3H2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29901_MNAB-Antibody-Western-Blot-NBP1-55060-img0007.jpg)
Western Blot: MNAB Antibody [NBP1-55060] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml RC3H2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.