Name | HIST1H3D Antibody (1D8) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00008351-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG3 Kappa |
Clone | 1D8 |
Applications | WB ELISA ICC/IF IHC-P |
Species Reactivities | Human |
Antigen | HIST1H3D (NP_003521, 1 a.a. - 60 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | HIST1H3D |
Conjugate | Unconjugated |
Supplier Page | Shop |