HIST1H3D Antibody (1D8)

Name HIST1H3D Antibody (1D8)
Supplier Novus Biologicals
Catalog H00008351-M01
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG3 Kappa
Clone 1D8
Applications WB ELISA ICC/IF IHC-P
Species Reactivities Human
Antigen HIST1H3D (NP_003521, 1 a.a. - 60 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Purity/Format IgG purified
Description Mouse Monoclonal
Gene HIST1H3D
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.