Myoferlin Antibody
| Name | Myoferlin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84694 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Myoferlin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MYOF |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Myoferlin Antibody [NBP1-84694] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/7145_Myoferlin-Antibody-Western-Blot-NBP1-84694-img0009.jpg)
Western Blot: Myoferlin Antibody [NBP1-84694] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunocytochemistry/Immunofluorescence: Myoferlin Antibody [NBP1-84694] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/7146_Myoferlin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84694-img0011.jpg)
Immunocytochemistry/Immunofluorescence: Myoferlin Antibody [NBP1-84694] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & vesicles.
![Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human cervix, uterine shows cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/7147_Myoferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84694-img0010.jpg)
Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human cervix, uterine shows cytoplasmic and membranous positivity in glandular cells.
![Western Blot: Myoferlin Antibody [NBP1-84694] - Analysis in human cell line A-431.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/7148_Myoferlin-Antibody-Western-Blot-NBP1-84694-img0008.jpg)
Western Blot: Myoferlin Antibody [NBP1-84694] - Analysis in human cell line A-431.
![Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/7149_Myoferlin-Antibody-Immunohistochemistry-Paraffin-NBP1-84694-img0001.jpg)
Immunohistochemistry-Paraffin: Myoferlin Antibody [NBP1-84694] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
![Simple Western: Myoferlin Antibody [NBP1-84694] - Simple Western lane view shows a specific band for MYOF in 0.2 mg/ml of RT-4, NIH-3T3 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/7150_Myoferlin-Antibody-Simple-Western-NBP1-84694-img0007.jpg)
Simple Western: Myoferlin Antibody [NBP1-84694] - Simple Western lane view shows a specific band for MYOF in 0.2 mg/ml of RT-4, NIH-3T3 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.