GEM Antibody

Name GEM Antibody
Supplier Novus Biologicals
Catalog NBP1-58906
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB ICC/IF IHC IHC-F IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to GEM(GTP binding protein overexpressed in skeletal muscle) The peptide sequence was selected from the C terminal of GEM (NP_005252). Peptide sequence FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene GEM
Conjugate Unconjugated
Supplier Page Shop

Product images