Crossveinless-2/CV-2/BMPER Antibody
| Name | Crossveinless-2/CV-2/BMPER Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58041 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to BMPER(BMP binding endothelial regulator) The peptide sequence was selected from the C terminal of BMPER. Peptide sequence NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | BMPER |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Crossveinless-2/CV-2/BMPER Antibody [NBP1-58041] - Human Fetal Heart Lysate, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29840_Crossveinless-2-CV-2-BMPER-Antibody-Western-Blot-NBP1-58041-img0001.jpg)
Western Blot: Crossveinless-2/CV-2/BMPER Antibody [NBP1-58041] - Human Fetal Heart Lysate, concentration 1 ug/ml.
![Immunohistochemistry-Paraffin: Crossveinless-2/CV-2/BMPER Antibody [NBP1-58041] - Human Lung](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29841_Crossveinless-2-CV-2-BMPER-Antibody-Immunohistochemistry-Paraffin-NBP1-58041-img0004.jpg)
Immunohistochemistry-Paraffin: Crossveinless-2/CV-2/BMPER Antibody [NBP1-58041] - Human Lung
![Immunohistochemistry-Paraffin: Crossveinless-2/CV-2/BMPER Antibody [NBP1-58041] - Human Lung, respiratory epethelium, 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29842_Crossveinless-2-CV-2-BMPER-Antibody-Immunohistochemistry-Paraffin-NBP1-58041-img0002.jpg)
Immunohistochemistry-Paraffin: Crossveinless-2/CV-2/BMPER Antibody [NBP1-58041] - Human Lung, respiratory epethelium, 5.0ug/ml.
![Immunohistochemistry-Paraffin: Crossveinless-2/CV-2/BMPER Antibody [NBP1-58041] - Human Lung.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29843_Crossveinless-2-CV-2-BMPER-Antibody-Immunohistochemistry-Paraffin-NBP1-58041-img0003.jpg)
Immunohistochemistry-Paraffin: Crossveinless-2/CV-2/BMPER Antibody [NBP1-58041] - Human Lung.