LYRM4 Antibody
| Name | LYRM4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79672 |
| Prices | $139.00, $369.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human Lyrm4The immunogen for this antibody is Lyrm4. Peptide sequence VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | Lyrm4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: LYRM4 Antibody [NBP1-79672] - Mouse Liver Lysate 1ug/ml Gel Concentration 10-20%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10237_LYRM4%2520Antibody-Western%2520Blot-NBP1-79672-img0001.jpg)
![Immunohistochemistry: LYRM4 Antibody [NBP1-79672] - Human kidney](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10238_LYRM4-Antibody-Immunohistochemistry-NBP1-79672-img0003.jpg)
![Immunohistochemistry-Paraffin: LYRM4 Antibody [NBP1-79672] - Human Skin](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10239_LYRM4-Antibody-Immunohistochemistry-Paraffin-NBP1-79672-img0002.jpg)