Name | Wnt-3a Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-74183 |
Prices | $369.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to the C terminal of Wnt3a. Immunizing peptide sequence IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA. |
Purity/Format | Immunogen affinity purified |
Blocking Peptide | Wnt-3a Blocking Peptide |
Description | Rabbit Polyclonal |
Gene | Wnt3a |
Conjugate | Unconjugated |
Supplier Page | Shop |