Wnt-3a Antibody

Name Wnt-3a Antibody
Supplier Novus Biologicals
Catalog NBP1-74183
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to the C terminal of Wnt3a. Immunizing peptide sequence IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA.
Purity/Format Immunogen affinity purified
Blocking Peptide Wnt-3a Blocking Peptide
Description Rabbit Polyclonal
Gene Wnt3a
Conjugate Unconjugated
Supplier Page Shop

Product images