NDUFA9 Antibody (3D7)
| Name | NDUFA9 Antibody (3D7) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00004704-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3D7 |
| Applications | WB ELISA ICC/IF IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | NDUFA9 (NP_004993 303 a.a. - 377 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | NDUFA9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7. Analysis of NDUFA9 expression in Raw 264.7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/3835_NDUFA9-Antibody-(3D7)-Western-Blot-H00004704-M01-img0013.jpg)
Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7. Analysis of NDUFA9 expression in Raw 264.7.
![Immunocytochemistry/Immunofluorescence: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on NIH/3T3 cell. Antibody concentration 10 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/3836_NDUFA9-Antibody-(3D7)-Immunocytochemistry-Immunofluorescence-H00004704-M01-img0008.jpg)
Immunocytochemistry/Immunofluorescence: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on NIH/3T3 cell. Antibody concentration 10 ug/ml.
![Immunohistochemistry-Paraffin: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 0.8 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/3837_NDUFA9-Antibody-(3D7)-Immunohistochemistry-Paraffin-H00004704-M01-img0010.jpg)
Immunohistochemistry-Paraffin: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 0.8 ug/ml.
![Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7. Analysis of NDUFA9 expression in PC-12.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/3838_NDUFA9-Antibody-(3D7)-Western-Blot-H00004704-M01-img0012.jpg)
Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7. Analysis of NDUFA9 expression in PC-12.
![Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7 Analysis of NDUFA9 expression in NIH/3T3.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/3839_NDUFA9%2520Antibody%2520(3D7)-Western%2520Blot-H00004704-M01-img0014.jpg)
Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7 Analysis of NDUFA9 expression in NIH/3T3.
![Sandwich ELISA: NDUFA9 Antibody (3D7) [H00004704-M01] - Detection limit for recombinant GST tagged NDUFA9 is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/3840_NDUFA9-Antibody-(3D7)-Sandwich-ELISA-H00004704-M01-img0011.jpg)
Sandwich ELISA: NDUFA9 Antibody (3D7) [H00004704-M01] - Detection limit for recombinant GST tagged NDUFA9 is approximately 0.1ng/ml as a capture antibody.