HOXA3 Antibody
| Name | HOXA3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83234 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSAPPSQP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HOXA3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HOXA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HOXA3 Antibody [NBP1-83234] - Analysis in control (vector only transfected HEK293T lysate) and hOXA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16686_HOXA3-Antibody-Western-Blot-NBP1-83234-img0007.jpg)
Western Blot: HOXA3 Antibody [NBP1-83234] - Analysis in control (vector only transfected HEK293T lysate) and hOXA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunocytochemistry/Immunofluorescence: HOXA3 Antibody [NBP1-83234] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16687_HOXA3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83234-img0008.jpg)
Immunocytochemistry/Immunofluorescence: HOXA3 Antibody [NBP1-83234] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human tonsil shows moderate nuclear positivity in reaction center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16688_HOXA3-Antibody-Immunohistochemistry-Paraffin-NBP1-83234-img0002.jpg)
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human tonsil shows moderate nuclear positivity in reaction center cells.