POLDIP1 Antibody
| Name | POLDIP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14147 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: RGEDEENREHRVRRIHVRRHITHDERPHGQQIVFKD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | POLDIP1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KCTD13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: POLDIP1 Antibody [NBP2-14147] - Analysis in control (vector only transfected HEK293T lysate) and KCTD13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4815_POLDIP1-Antibody-Western-Blot-NBP2-14147-img0006.jpg)
Western Blot: POLDIP1 Antibody [NBP2-14147] - Analysis in control (vector only transfected HEK293T lysate) and KCTD13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
![Immunocytochemistry/Immunofluorescence: POLDIP1 Antibody [NBP2-14147] - Staining of human cell line A-431 shows localization to nucleus & nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4816_POLDIP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14147-img0007.jpg)
Immunocytochemistry/Immunofluorescence: POLDIP1 Antibody [NBP2-14147] - Staining of human cell line A-431 shows localization to nucleus & nuclear bodies.
![Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/4817_POLDIP1-Antibody-Immunohistochemistry-Paraffin-NBP2-14147-img0004.jpg)
Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells.