PMP70 Antibody (CL2524)

• Supplier: Novus Biologicals
• Catalog: NBP2-36770
• Prices: $129.00, $419.00
• Sizes: 25 µl, 100 µl
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone: CL2524
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP
• Purity/Format: Protein A purified
• Description: Mouse Monoclonal
• Gene: ABCD3
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in U251 cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human small intestine shows strong granular cytoplasmic immunoreactivity in the glandular epithelium.

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in HeLa cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human cell line A431 showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in MCF7 cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Immunocytochemistry/Immunofluorescence: PMP70 Antibody (CL2524) [NBP2-36770] - Staining in U2OS cell line showing specific staining of peroxisomes in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human rectum shows strong granular cytoplasmic immunoreactivity in glandular cells.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human prostate shows granular cytoplasmic positivity in glandular cells.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human liver shows strong granular cytoplasmic immunoreactivity in hepatocytes.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.

Immunohistochemistry: PMP70 Antibody (CL2524) [NBP2-36770] - Staining of human kidney shows strong granular cytoplasmic immunoreactivity in renal tubules.