MINOS1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31802
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: MINOS1 Protein
• Description: Rabbit Polyclonal
• Gene: MINOS1

Product images

Immunocytochemistry/Immunofluorescence: MINOS1 Antibody [NBP2-31802] - Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.

Immunohistochemistry: MINOS1 Antibody [NBP2-31802] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Immunohistochemistry: MINOS1 Antibody [NBP2-31802] - seminal vesicle

Immunohistochemistry: MINOS1 Antibody [NBP2-31802] - liver cancer