TSPAN13 Antibody
| Name | TSPAN13 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81001 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TSPAN13 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TSPAN13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TSPAN13 Antibody [NBP1-81001] - Staining of human pancreas cryosection (200x). Ducts are labeled. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21847_TSPAN13-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81001-img0005.jpg)
Immunocytochemistry/Immunofluorescence: TSPAN13 Antibody [NBP1-81001] - Staining of human pancreas cryosection (200x). Ducts are labeled. Image from verified customer review.
![Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human breast shows cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21848_TSPAN13%2520Antibody-Immunohistochemistry-Paraffin-NBP1-81001-img0006.jpg)
Immunohistochemistry-Paraffin: TSPAN13 Antibody [NBP1-81001] - Staining of human breast shows cytoplasmic positivity in glandular cells.