NHE3/SLC9A3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-82574
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-F IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: NHE3/SLC9A3 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: SLC9A3
• Conjugate: Unconjugated

Product images

Western Blot: NHE3/SLC9A3 Antibody [NBP1-82574] - Analysis in control (vector only transfected HEK293T lysate) and sLC9A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human small intestine shows strong apical membrane positivity in glandular cells.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human kidney shows strong apical membrane positivity in cells in tubules.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human colon shows strong apical membrane positivity in glandular cells.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Immunohistochemical staining of human liver shows no positivity as expected.