C6orf64 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-83781
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Mouse, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:LFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLA
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: C6orf64 Protein
• Description: Rabbit Polyclonal
• Gene: SAYSD1

Product images

Western Blot: C6orf64 Antibody [NBP1-83781] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).

Immunocytochemistry/Immunofluorescence: C6orf64 Antibody [NBP1-83781] - Staining of human cell line U-2 OS shows positivity in vesicles.

Immunohistochemistry-Paraffin: C6orf64 Antibody [NBP1-83781] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Western Blot: C6orf64 Antibody [NBP1-83781] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Product References

Tissue profiling of the mammalian central nervous system using human - Tissue profiling of the mammalian central nervous system using human

Mulder J, Bjorling E, Jonasson K, Wernerus H, Hober S, Hokfelt T, Uhlen M. Mol Cell Proteomics. 2009 Jul;8(7):1612-22.

Systematic validation of antibody binding and protein subcellular localization - Systematic validation of antibody binding and protein subcellular localization

Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlen M, Lundberg E. J Proteomics. 2012 Apr 3;75(7):2236-51.