TBC1D14 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-32678
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: MGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKLKLRALEDRHSLQSVDSGIPTLEIGNPEPVPCSAVHVRRKQSDSDLIPER
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: TBC1D14 Protein
• Description: Rabbit Polyclonal
• Gene: TBC1D14

Product images

Western Blot: TBC1D14 Antibody [NBP2-32678] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412328)

Immunohistochemistry: TBC1D14 Antibody [NBP2-32678] - Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry: TBC1D14 Antibody [NBP2-32678] - cerebral cortex

Immunohistochemistry: TBC1D14 Antibody [NBP2-32678] - liver cancer