C19orf54 Antibody

Name C19orf54 Antibody
Supplier Novus Biologicals
Catalog NBP2-32418
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: CGLVALWMAGTLLSPPSGVPLERLIRVATERGYTAQGEMFSVADMGRLAQEVLGCQAKLLSGGLGGPNRDLVL
Purity/Format Immunogen affinity purified
Blocking Peptide C19orf54 Protein
Description Rabbit Polyclonal
Gene C19orf54
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.