RCN2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-32010
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: AEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDK
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: RCN2 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: RCN2
• Conjugate: Unconjugated

Product images

Western Blot: RCN2 Antibody [NBP2-32010] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32010] - Staining of mouse thalamus shows positivity in neurons of the parafascicular nucleus.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32010] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32010] - Staining of mouse locus coeruleus shows immunoreactivity in neurons.

Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32010] - Staining of mouse red nucleus shows strong immunoreactivity in neurons.

Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32010] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.

Immunohistochemistry: RCN2 Antibody [NBP2-32010] - Staining of testis.

Immunohistochemistry: RCN2 Antibody [NBP2-32010] - Staining of breast cancer.

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32010] - Staining of cerebral cortex shows moderate cytoplasmic immunoreactivity in neuronal cell bodies.