AIF1L Antibody
| Name | AIF1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32004 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: HLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | AIF1L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | AIF1L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: AIF1L Antibody [NBP2-32004] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/7008_AIF1L-Antibody-Western-Blot-NBP2-32004-img0004.jpg)
Western Blot: AIF1L Antibody [NBP2-32004] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunohistochemistry-Paraffin: AIF1L Antibody [NBP2-32004] - Staining of human kidney shows strong membranous cytoplasmic positivity in cells in tubules and cells in glomeruli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/7009_AIF1L-Antibody-Immunohistochemistry-Paraffin-NBP2-32004-img0005.jpg)
Immunohistochemistry-Paraffin: AIF1L Antibody [NBP2-32004] - Staining of human kidney shows strong membranous cytoplasmic positivity in cells in tubules and cells in glomeruli.
![Immunohistochemistry: AIF1L Antibody [NBP2-32004] - Staining of human kidney shows strong membranous and cytoplasmic positivity in kidney tubules and glomeruli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/7010_AIF1L-Antibody-Immunohistochemistry-NBP2-32004-img0001.jpg)
Immunohistochemistry: AIF1L Antibody [NBP2-32004] - Staining of human kidney shows strong membranous and cytoplasmic positivity in kidney tubules and glomeruli.
![Immunohistochemistry: AIF1L Antibody [NBP2-32004] - Staining of liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/7011_AIF1L-Antibody-Immunohistochemistry-NBP2-32004-img0002.jpg)
Immunohistochemistry: AIF1L Antibody [NBP2-32004] - Staining of liver.
![Immunohistochemistry: AIF1L Antibody [NBP2-32004] - Staining of liver cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/7012_AIF1L-Antibody-Immunohistochemistry-NBP2-32004-img0003.jpg)
Immunohistochemistry: AIF1L Antibody [NBP2-32004] - Staining of liver cancer.