GP2 Antibody
| Name | GP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59912 |
| Prices | $369.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GP2(glycoprotein 2 (zymogen granule membrane)) The peptide sequence was selected from the middle region of GP2. Peptide sequence SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GP2 Antibody [NBP1-59912] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29907_GP2-Antibody-Western-Blot-NBP1-59912-img0008.jpg)
Western Blot: GP2 Antibody [NBP1-59912] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: GP2 Antibody [NBP1-59912] - Staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29908_GP2-Antibody-Immunohistochemistry-NBP1-59912-img0006.jpg)
Immunohistochemistry: GP2 Antibody [NBP1-59912] - Staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
![Western Blot: GP2 Antibody [NBP1-59912] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29909_GP2-Antibody-Western-Blot-NBP1-59912-img0005.jpg)
Western Blot: GP2 Antibody [NBP1-59912] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.
![Western Blot: GP2 Antibody [NBP1-59912] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that GP2 is expressed in HepG2](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29910_GP2-Antibody-Western-Blot-NBP1-59912-img0007.jpg)
Western Blot: GP2 Antibody [NBP1-59912] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that GP2 is expressed in HepG2