Claudin-18 Antibody

Name Claudin-18 Antibody
Supplier Novus Biologicals
Catalog NBP1-60010
Prices $369.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLDN18(claudin 18) The peptide sequence was selected from the C terminal of CLDN18. Peptide sequence PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLDN18
Conjugate Unconjugated
Supplier Page Shop

Product images