SSR2 Antibody
| Name | SSR2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69471 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SSR2(signal sequence receptor, beta (translocon-associated protein beta)) The peptide sequence was selected from the N terminal of SSR2. Peptide sequence SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSA |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SSR2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SSR2 Antibody [NBP1-69471] - This Anti-SSR2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25624_SSR2-Antibody-Western-Blot-NBP1-69471-img0001.jpg)
![Immunohistochemistry: SSR2 Antibody [NBP1-69471] - Staining of human Muscle.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25625_SSR2%2520Antibody-Immunohistochemistry-NBP1-69471-img0002.jpg)